Monkshood
Linguis loquuntur lingua est lingua mortis
Quod creat inlusione profunditatem
a alludens ad pane mucido antiquitatis
Cum superbia, Narcissi lacrimam educunt fetus,
et offerunt venenum in nomine sanctitatis
Est Aconitum napellus
Frustra conati sunt senes fieri virgines
circumdatio prodigiosum indumentum
Urbi et orbi, solae communes natos, consortia tecta
urbis habent magnisque agitant sub legibus aevum
aliae, sacerdotes purissima mella stipant
et expugnationis stultus insecta in gluten
furto pecunia, sepultum, victimas
concupiscendum rapta filios
Ergo apibus cum mortui arcana
Lignum vitae, reductio ad absurdum
------------------------------------------------------------------
Vatican Radio Easter Message Urbi et Orbi of His Holiness Benedict
Easter Message Urbi et Orbi of His Holiness Benedict XVI Dear
Brothers and Sisters throughout the world, Men and women of good
will! Christ is risen! Peace to ...
en.radiovaticana.va/articolo.asp?c=127354
------------------------------------------------------------------
Monks Hoodies
MONKS clothing was designed to give individuals a unique
alternative to the modern day hooded sweatshirt. Unlike other
hooded sweatshirts, MONKS hooded ...
www.monkshoodies.com/
------------------------------------------------------------------
http://www.erudit.org/revue/ron/1997/v/n8/005773ar.html
Written near the height of French de Christianization, The Monk
embodies this tension, but set in Spain. If, as was broadly
assumed, Catholic authoritarianism was the precondition of the
Terror
What, though, was the real driving force behind this conspiracy?
Catholics tended to assume that it was Protestantism.
Conversely, Protestants blamed the Catholics. "Popery was
no longer [to Britain] the enemy as such, but it was frequently
cited as the influence that had created the despotic state of
affairs from which the Revolution had emerged. Protestant
England had made 1688 possible; Catholic France had made
1789 and 1792 inevitable
------------------------------------------------------------------
Sluggo's House O' Spookiness: Mission La Purisima, Lompoc, CA
... main building, the chapel, people have reported seeing a
monk walking the halls, ... Commentary: The La Purisima
Concepcion state park exists at the second ... La Purisima is
often described as the "most haunted" mission
sluggosghoststories.blogspot.com/.../mission-la-purisima-lompoc-ca...
------------------------------------------------------------------
La Purisima Concepcion Catholic School
By the time students at La Purisima Concepcion School graduate,
we expect them to be Physical Learners who make good nutrition
and physical fitness part of ...
www.lapurisimaschool.org/
------------------------------------------------------------------
http://en.wikipedia.org/wiki/HMS_Cerberus_(1794)
Seven days later, Arethusa and Cerberus captured the Purissima
Conceptione.
HMS Cerberus was a 32-gun fifth-rate frigate of the Royal Navy.
She served in the French Revolutionary and the Napoleonic Wars
------------------------------------------------------------------
http://sluggosghoststories.blogspot.com/2009/06/mission-la-
purisima-lompoc-ca.html
I lived, for a time, just a few miles from Mission La Purisima
Concepcion, just outside of the town of Lompoc, near Vandenberg
Air Force Base.
Cold spots and feelings of being watched are common, as are the
sounds of voices. Some people have claimed that "energy vortexes"
(often claimed, never explained) are found within the chapel.
------------------------------------------------------------------
http://basyevortex.com/index.php?option=com_content&task=view&id=83&Itemid=119
The Huguenots, Basyes among them no doubt, were persecuted by
the Roman Catholic monarchy of France and fled abroad in steady
numbers ("like the passing of sands through an hour glass,"
writes O.B.) in the sixteenth, seventeenth and eighteenth
centuries, all the way up to the French Revolution.
The French-language Wikipedia website says that 300,000
Huguenots left France after the "dragonnades" (Louis the XIV's
repressive attacks against protestants, which started in 1681)
and the revocation of the Edict of Nantes in 1685. The latter
had been enacted in 1598 by King Henry IV, a quasi-protestant
whose law had somewhat protected protestants for almost a
century. Huguenots referred to the period between the revocation
of the Edict of Nantes and the start of the French Revolution,
as "the Desert." When Huguenots came to America, it was often
the second stage of emigration, by way of England, or from
Holland.
Genealogy of a Vortex
The origins of the name Basye, the debate over the origins of
the term "huguenot," and the dynamics of the struggle between
the French Roman Catholics and Protestants are relevant to the
Basye vortex because, first of all, they underline that in
addition to German influences in the Shenandoah Valley and in
the Basye area, which deserve study in themselves, there is a
French component to the very beginnings of the Basye community --
a vitally important one. More than that, these things say
something quite specific and not fully understood about that
French component. They support the perception that a
relationship between Basye's psychic energy and certain French
merely fanciful construction by New Age intellectuals and "pop
mystics," but that it has a solid basis in history and even
genealogy.
Isaac Walter Basye wrote the following letter to the Boston
Evening Transcript newspaper, in 1903 and we admit our thoughts
have returned to these cryptic words from time to time:
"Possibly one day, some day, one or more of the [Basye]
lineage shall rise in the firmament of thought and action to
be a star of the first magnitude, and then there will be a
hustling to analyze the genealogical blood. It will not then
be asked, "Is not this the carpenter's son," but whose son is
he?"
In other words, the thread we find with the Basye family, goes
back from the Shenandoah Valley to the French Reformation, and
the pre-Huguenot thread we find there goes back to the era
before reformation had a name, to the 12th century, and before
that, to the era of Hugues Capet.
We are now talking about the secret behind genetics and
genealogies, that is, the field of the emergence of species and
our taxonomies, which is phylogeny. What is the connection
between actual DNA as it evolves, and events that happen to the
establish attributes and abilities that get coded therein?
Phylogenetics is concerned with the development of specific
traits in a species -- or a family. Hugues Capet's genealogy
goes directly to Charlemagne (he was a direct descendant on both
sides of his family); but psychologically / spiritually, in
terms of transmitted / inherited thought forms -- indeed, "the
geneaology of a vortex" -- it can be argued, the reformation
spirit goes to the simple, direct perception of the gnostics who
walked with Christ, and whose reports are to be found in the Nag
Hammadi texts.
By the way -- it may seem over-reaching to concern ourselves
with names, etymologies and history to this extent, but in
taking seriously the reports of vortex energies we are in effect
borrowing an "occultist's hat," and in most occult or mystical
ways of interpreting reality, the provenance and history of a
name are relevant to the psychic energies and "thought forms"
the name projects.
------------------------------------------------------------------
http://www.poetryfoundation.org/learning/essay/238696
"Long Live the Vortex!" and "Our Vortex" (1914)
by Wyndham Lewis
Poets T.S. Eliot and Ezra Pound, who is said to have given the
movement its name, were briefly associated with the Vorticists.
Lewis published two issues of the Vorticist magazine BLAST, in
June 1914 and July 1915, in which these two pieces of his
appeared, along with work by Pound and Eliot. "Long Live the
Vortex!" is an introductory manifesto
Long live the great art vortex sprung up in the centre of this town!
We stand for the Reality of the Present- not for the sentimental
Future, or the sacripant Past.
We want to leave Nature and Men alone.
It may be said that great artists in England are always
revolutionary, just as in France any really fine artist had a
strong traditional vein.
Blast sets out to be an avenue for all those vivid and violent
ideas that could reach the Public in no other way.
A VORTICIST KING! WHY NOT?
Elephants are VERY BIG. Motor cars go quickly.
Wilde gushed twenty years ago about the beauty of machinery.
Gissing, in his romantic delight with modern lodging houses was
futurist in this sense.
The futurist is a sensational and sentimental mixture of the
aesthete of 1890 and the realist of 1870.
Our Vortex is fed up with your dispersals, reasonable chicken-men.
We have no Verbotens,
The Rembrandt Vortex swamped the Netherlands with a flood of dreaming.
The Turner Vortex rushed at Europe with a wave of light
Our Vortex will not hear of anything but its disastrous polished dance.
Our Vortex rushes out like an angry dog at your Impressionistic fuss.
Blast presents an art of Individuals.
------------------------------------------------------------------
The Last Crisis: Pope Speaks Out Against Individualism
The Eucharist is the medicine which can heal our individualist
society, Pope Benedict XVI said in his midday Angelus address on
Corpus ...
lastcrisis.blogspot.com/.../pope-speaks-out-against-individualism.html
------------------------------------------------------------------
Occupy Wall Street, Benedict XVI and "The Vortex"
No, "Pope" Ratzinger's Modernist lies and falsehoods never get
"trapped and exposed" on The Vortex, because they never even get
discussed there; it's like ...
www.novusordowatch.org/ows_b16_vortex.htm
------------------------------------------------------------------
http://www.novoprotein.com/product/cerberus-1_Human.htm
Novoprotein
HEK293
Description Recombinant Human Cerberus 1/CER1 is produced with
our mammalian cells expression system in HEK293. The target
protein is expressed with sequence (Met1-Ala267) of Human CER1
fused with a polyhistidine tag at the C-terminus
Reconstitution Always centrifuge tubes before opening.
Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less
than 100 ug/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Amino Acid Sequence
TRHQDGRQNQSSLSPVLLPRNQRELPTGNHEEAEEKPDLFVAVPHLVGTSPAGEGQRQRE
KMLSRFGRFWKKPEREMHPSRDSDSEPFPPGTQSLIQPIDGMKMEKSPLREEAKKFWHHF
MFRKTPASQGVILPIKSHEVHWETCRTVPFSQTITHEGCEKLVVQNNLCFGKCGSVHFPG
AAQHSHTSCSHCLPAKFTTMHLPLNCTELSSVIKVVMLVEECQCKVKTEHEDGHILHAGS
QDSFIPGVSAVDHHHHHH*
Background
Cerberus 1 is a secreted glycoprotein that forms disulfide-
linked homodimers. It is a cytokine member of the DAN domain
family of BMP antagonists that includes DAN (DAND1), Gremlin/Drm
(DAND2), PRDC (Protein Related to Dan and Cerberus, DAND3), and
COCO/Dante (DAND5). DAN family members contain a cysteine knot
domain that is homologous to that found in other TGF-beta
superfamily ligands. At the onset of gastrulation, Cerberus 1 is
transiently expressed in anterior endodermal structures in
response to Nodal and Shh. Cerberus 1 binds BMP-4 and Nodal and
inhibits their activities. The inhibitory functions of Cerberus
favor mesodermal development in the anterior region of the
gastrula and suppresses posterior mesodermal differentiation. In
chick and Xenopus, Cerberus 1 also regulates, but is not
required for embryonic left-right polarization, neurulation, and
head and heart induction.
------------------------------------------------------------------
Port Forwarding XBOX360 Oneechanbara vorteX on the Pentagram Cerberus
.portforward.com/.../Cerberus/XBOX360_Oneechanbara_vorteX.htm
------------------------------------------------------------------
http://bostoncatholicinsider.wordpress.com/2011/05/24/temporary-truce/
Jack Connors got the real estate he needed for BC by sitting on
the finance council while heading the BC board of trustees. He
got the Caritas hospitals a bit lower hanging on the branch (via
Cerberus) for Partners to cherry pick in the not-to-distant
future by returning to the finance council. And he has thereby,
in my opinion, compromised the ordinary to the point of risking
his salvation.
Boston Bob says:
Just a thought. Since it appears the Cardinal is not going to
take stand up to Jack Connors on abortion and Jack is too
arrogant and powerful to care, the answer may be to engage pro-
life Catholic philanthropists such as John McNiece, Peter Lynch
and Jack Shaugnessey, among others, to stand up and challenge
Connors in terms of the scandal he brings to the Church.
Anonymous Catholic says:
Boston Bob, it might be feasible to engage perhaps one of the 3
people you named?Jack Shaughnessey, who is very pro-life and a
very generous supporter of Catholic causes. If I knew him
personally, I'd ask him, but I don't.
As for the other two, one is a pro-life Catholic philanthropist
but is in failing health. The other is a Catholic philanthropist
who has focused primarily on Catholic schools
------------------------------------------------------------------
http://en.wikipedia.org/wiki/HMS_Cerberus_(1794)
In July 1799 Cerberus recaptured the Philanthropist.
French Revolutionary Wars
Cerberus was launched in September 1794 by Henry Adams,
of Bucklers Hard.
------------------------------------------------------------------
The French Revolution and the Catholic Church | Suite101
At the start of the French Revolution the Catholic Church was ...
ran their own courts, collected a tithe, and held a monopoly on
education.
suite101.com/.../the-french-revolution-and-the-catholic-churc...
------------------------------------------------------------------
"Virgin Mary" to attack Israeli naval control off Gaza - News that matters
Dubbed the "Mariam" in honor of Virgin Mary, the ship will carry
50 women, most of them Christian and the rest Muslim. A Lebanese
ship ...
ivarfjeld.wordpress.com/.../virgin-mary-to-attack-israeli-naval-...
------------------------------------------------------------------
http://en.wikipedia.org/wiki/HMS_Cerberus_(1794)
Cerberus was in company with Diana, when Diana took the cutter
Neptune on 12 September and after a nine-hour chase. Neptune was
armed with 12 guns and had a crew of 55 men. She was three days
out of Lorient and had taken no prizes
------------------------------------------------------------------
Death of Princess Diana: Least-aspected Neptune
Essay on how the planetary metaphor of least-aspected Neptune
was reflected in the death of Princess Diana, by award-winning
astrocartographer Rob ...
members.tripod.com/tra_nations/1b_prin_di_death.htm
------------------------------------------------------------------
Princess Diana's butler asked a Catholic priest if she could marry
Father Anthony Parsons of the Carmelite Church in Kensington, ...
Princess Diana's butler asked a Catholic priest if she could
marry a Muslim ...
http://newsagency.thecheers.org/Europe/news_8799_Princess-Dianas-
butler-asked-a-Catholic-priest-if-she-could-marry-a-Muslim.html
------------------------------------------------------------------
Strange confluence of Catholic and royal events continues
Mother Teresa and Princess Diana together in New York in 1997,
months ... Relations between the monarchy and the Roman Catholic
Church ...
http://religion.blogs.cnn.com/2011/04/28/strange-confluence-of-
catholic-and-royal-events-continues-this-weekend/
------------------------------------------------------------------
HMS Neptune (1797) - Wikipedia, the free encyclopedia
HMS Neptune was a 98-gun second rate ship of the line of the
Royal Navy. She served on a number of stations during the French
Revolutionary and Napoleonic ...
en.wikipedia.org/wiki/HMS_Neptune_(1797)
------------------------------------------------------------------
Heresy Hunting: The Monk and the French Revolution
... and the French Revolution as well as that novel and anti-
Catholic polemics. ... of their own; and they have learnt to
talk against monks with the spirit of a monk.
www.erudit.org/revue/ron/1997/v/n8/005773ar.html
------------------------------------------------------------------
http://www.paghat.com/monkshoodnapellus.html
Somewhere around 1840, two Catholic priests arrived to dinner
with other guests of the Provost of Dingwall. A servant obtained
a radish from the garden for the guests to use as garnish on
their meat, in consequence of which three at the table died,
including Father Angus Mackenzie, Father James Gordon, & Father
Gordon's grand-nephew.
A final tale belongs here since the species attached to this
legend is certainly A. napellus & no other. Monkshood has
another old folk-name, St. Dunstan's Herb, & in portraits of St.
Dunstan, tenth century Archbishop of Canterbury, monkshood is
often present.
A. napellus is one of the most poisonous of this highy toxic
genus. It was used throughout Europe as a wolf poison, & in
India as a tiger poison, lacing meat left for the mankillers to
scavenge. Several of its common names allude to this value:
Wolfsbane, Leopard Bane, Tiger Bane, Dog's Bane, & occasionally,
a mite absurdly, Wolf's Hat. It was even called Mousebane, due
to Pliny's absurd claim that it was so potent a poison that the
very odor of it would kill a mouse at a great distance.
The marvelously unique shape of the blossoms gave rise to the
most common name, Monkshood, but other names alluding to its
helmet-like shape have included Friar's Cap, Friar's Cowl,
Helmet Flower, Soldier's Helmet, Cuckoo's Cap, Turk's Cap, or
among ancient Germanic peoples, Thor's Helm
The monkshood shown in the first three photos on this page was
sold without a cultivar name & it may really be the wild form of
Aconitum napellus
A final tale belongs here since the species attached to this
legend is certainly A. napellus & no other. Monkshood has
another old folk-name, St. Dunstan's Herb, & in portraits of St.
Dunstan, tenth century Archbishop of Canterbury, monkshood is
often present. Dunstan was said once to have held the devil by
the nose with a pair of red-hot tongs, forcing from him an oath
to never again tempt the saint. Shortly thereafter Dunstan
dreamt of an enormous branching spire of flowers shaped like the
cowls of monks, & interpretted this as indicative of
Christianity spreading throughout a future England ruled by
Catholic clergy. A most curious legend for Catholics to tell of
themselves
In mythology, Monkshood was nefarious Medea's poison of choice.
Ovid said she gathered it in Scythia, where it first grew from
the slobber of three-headed Cerberus
------------------------------------------------------------------
cleopatra-and-murder.html
The poison, according to Greek mythology, could be found at the
gates of hell. It dripped from the jaws of Cerberus, the hulking
three-headed dog that guarded the entrance to the underworld.
And when the dog drooled on the ground, strangely beautiful
flowers sprang up, each one poisonous at its heart.
The poison always carried the taint of dark magic. People called
it wolfsbane, dogsbane, even -- rather horrifyingly -- wifesbane.
Its reputation called to writers over the years. Oscar Wilde
used it in his story of a determined murderer, Lord Arthur
Savile's Crime
Today, we tend to refer to this poison rather prosaically as
aconite. I love the notion of it being drooled by hellish dogs
but, in fact, it's simply part of the internal chemistry of a
rather decorative plant popularly called monkshood, with the
Latin name of Aconitum napellus.
------------------------------------------------------------------
Monkey Hat Monkey Costume Monkey Hood Ear Hat by talk2thetrees
Ever feel like monkeying around? Then this hat is perfect for
you! This hat is comfortable and warm, and has long flaps that
can be tied under the
www.etsy.com ? talk2thetrees ? Animal Hats/Hoods
------------------------------------------------------------------
Monkey bones (Zombie) - The RuneScape Wiki
[view] talk Monkey bones are a form of bones that can only be
obtained by killing level 98...
runescape.wikia.com/wiki/Monkey_bones_(Zombie)
------------------------------------------------------------------
MONKEYBONE screenplay by Sam Hamm based on the comic book
"Dark Town " by Kaja Blackley and Vanessa Chong SEVENTH DRAFT 3
www.dailyscript.com/scripts/MonkeyBone_script.htm
------------------------------------------------------------------
Italy: the dark side, The Capuchini Bone Chapel in Rome
It is said monks fled the French Revolution (1793-94) and took
refuge at the Church in ... wear sandals with no socks, and a
tunic with a rope belt, and a hood.
www3.sympatico.ca/tapholov/pages/bones.html
A child-size Grim Reaper.
BONES
We were so enamoured of the place that we returned on our last
day in Roma to see it again. Entrance is by donation, the door
manned by a Capuchin monk. The bones in this crypt were nailed
to the wall and arranged in patterns: cross, floral, arch,
triangle and circle, as well as forming objects. A large clock
is composed of vertebrae, foot bones and finger bones. The
single hour hand represents the idea that time has no beginning
or end.
------------------------------------------------------------------
Warrior Cats World - View Profile: Cerberus (AKA Bones)
If you are an existing member, please login below. Otherwise,
please register. STAFF: Cerberus (Bones) , Moss , Mystic They
keep the place nice and happy!
warriorcatsfanclan.proboards.com/index.cgi?action=viewprofile...
------------------------------------------------------------------
http://womenincrimeink.blogspot.com/2010/08/of-cerberus-
http://www.readcentral.com/chapters/William-Butler-Yeats/
The-Trembling-of-the-Veil/076
"At moments when I have thought of the results of political
subjection upon Ireland I have remembered a story told me by
Oscar Wilde who professed to have found it in a book of magic,
"if you carve a Cerberus upon an emerald," he said, "and put it
in the oil of a lamp and carry it into a room where your enemy
is, two heads will come upon his shoulders and devour one
another."
- William Butler Yeats
------------------------------------------------------------------
http://en.wikipedia.org/wiki/Population_history_of_indigenous_
peoples_of_the_Americas
Depopulation from disease
Using an estimate of approximately 30 million people in 1492
(including 15 million in the Aztec Empire and six million in the
Inca Empire), the lowest estimates give a death toll due from
disease of an astonishing 80% by the end of the 17th century
(eight million people in 1650).
Nearly all scholars now believe that widespread epidemic disease,
to which the natives had no prior exposure or resistance, was
the overwhelming cause of the massive population decline of the
Native Americans. They reject both of the earliest European
immigrants' explanations for the population decline of the
American natives. The first explanation was the brutal practices
of the Spanish conquistadores, as recorded by the Spanish
themselves. This was applied through the encomienda which was a
system ostensibly set up to protect people from warring tribes
as well as to teach them the Spanish language and the Catholic
religion, but in practice was tantamount to slavery.
Soon after Europeans and Africans began to arrive in the New
World, bringing with them the infectious diseases of Europe and
Africa, observers noted immense numbers of indigenous Americans
began to die from these diseases. One reason this death toll was
overlooked is that once introduced the diseases raced ahead of
European immigration in many areas. Disease killed off a sizable
portion of the populations before European observations (and
thus written records) were made. After the epidemics had already
killed massive numbers of natives, many newer European
immigrants assumed that there had always been relatively few
indigenous peoples. The scope of the epidemics over the years
was tremendous, killing millions of people- possibly in excess of
90% of the population in the hardest hit areas- and creating one
of "the greatest human catastrophe in history, far exceeding
even the disaster of the Black Death of medieval Europe"
Deliberate infection
One of the most contentious issues relating to disease
depopulation in the Americas concerns the degree to which
Europeans deliberately infected indigenous peoples with diseases
such as smallpox.
------------------------------------------------------------------
Conjurella Monks 1
Conjurella Messiah: Necronomicon Monks. Abomination ... David
Ferrie is dead; Dallas is an aborted memory, a dream that
couldn'tbe. But Cosmicon II will be ...
karws.gso.uri.edu/jfk/conspiracy.../Conjurella_Monks1.html
This is the story of Conjurella Con II. No, the blood has dried
now; the Conjurella memories are no more. Gone the voices: "Lift
him up!", gone the memory, gone the blood. It is a decade
beyond 1963 now: ten years are passing. No longer Dallas, but
Toronto. David Ferrie is dead. We are free.
In one world, THE PROJECT is the Port Hope office of MK-ULTRA, a
hellish reality of forced drug and hypnosis experiments on
children, that will lead to the asassination of the President.
In the days preceding Cosmicon II, I had met, first Asian A,
then American A, and fallen in love with them both. They weren't
spies, public figures, or comic book publishers, so to put them
among the Necronomicon Monks, they must be half known and half
concealed
Within these doors, there are no memories of the aborted
invasion, no memories of the single shot which my hand fired, no
memories of Christian Anti-Communism or Fair Play for Cuba...
only comic books, not the child assassin, but the poet,
not the pawn of Dr. E and MK-ULTRA
The story of the Necronomicon Monks is truth, but it is absurd
truth
The Necronomicon was discovered by the Holy Office of the
Inquisition, and sealed behind stone in a monastery in Tibet...
even they, who could slaughter thousands of their own kind,
still feared its dark power.
No: I bear the Dulles Stigmata: protracted delusions of a
religious or occult nature, which are the trademark symptom of
those who were subjected to the CIA's illegal mind-control
experiments of the 1950s, directly overseen by CIA Director, and
later Warren Commission member, Allen Dulles.
I was no credible witness, then or now. But I knew Dr. E and
David Ferrie were creating a disease to attack Africa. It must
have been 1966 when David Ferrie told me they had successfully
infected someone. "It's going to fly!" David Ferrie said of the
AIDS virus, grinning proudly. Daddy smiled a sheepish smile, and
nodded. He was afraid then. So am I. Even now.
------------------------------------------------------------------
http://hivalleyaid.tripod.com/Reviews.html
U.S. Project "mk-ultra": Covered by hatred, division and disinformation.
Many reputable authors suggest that HIV was cooked up in
Biological Warfare Laboratories of the United States as part of
the Cold War.
Dr. Leonard G. Horowitz, claims much the same scenario in his
book Emerging Viruses: AIDS and Ebola: Nature, Accident or
Intentional? He goes further to name the names of who (The
Director, Dr. Wolf Smuzness) at the New York City Blood Supply
knowingly contrived the initial HIV laced Hepatitus B vaccine
tests targetting gays. He notes when these tests occurred,
coincidentally with the arrival of AIDS in each of the test
cities. He cites who funded the "research" including which state
agencies and drug companies played pivotal roles. He even ties
back psychological history of key players up to and including
our current Pope John Paul II. He traces volumes of money from
key sources into U.S. biological weapons research.
See what other readers have said by connecting to Amazon.com here
------------------------------------------------------------------
The Nazi Hydra in America: Suppressed History of a Century
Dulles had contacts with the Vatican before the ratline. His
first ... The truth behind the CIA-Nazi connection
has remained buried through the efforts of such men as
Allen Dulles and George H. W. Bush.
books.google.com/books?isbn=0930852435
------------------------------------------------------------------
Don't mention the Pope's Hitler Youth past, says the Vatican
May 12, 2009 - Late yesterday Father Lombardi withdrew his
earlier comments, saying that Benedict had, indeed, been forced
to join the Hitler Youth.
www.telegraph.co.uk - ... - Europe - Vatican City and Holy
------------------------------------------------------------------
http://viciouspaperclip.blogspot.com/
Vi Veri Universum Vivus Vici - A Paperclip Tale
II - Response to Latest Speech by Pope Benedict
------------------------------------------------------------------
Operation PaperClip. nazi,cia,nazi scientist,german scientist,allen
As promised, Allen Dulles delivered the Nazi Intelligence unit
to the CIA, which .... This is why the CIA and the Vatican had
go through with Operation Paperclip
www.theforbiddenknowledge.com/.../operationpaperclip.htm
------------------------------------------------------------------
The Woman Rebel "No Gods, No Masters": Nazi Pope:
He was a Nazi. ... Pope likens "saving" gays to saving the
rainforest ... VATICAN CITY, Dec 22 (Reuters) - Pope Adolf
(Benedict) said on Monday that saving humanity from ....
Hundreds of Brazil's Eco-Warriors at Risk of Assas.
http://womanrebel.blogspot.com/2008/12/nazi-pope-protect-humanity-from.html
Nazi Pope: 'Protect' humanity from homosexuality
[ Pope Adolf the red Prada pump wearing former Hitler Youth is a
figure of such utter absurdity as to be a character in one of
those absurdist plays by Jen Genet (The Maids) or Eugene Ionesco
(The Bald Soprano). Here is an old queen who wears ermine stole
and satin gowns covered with ornate embroidery and the finest
red pumps made by Prada condemning homosexuality. a man who in
his youth tacitly if not actively was part of an extreme anti-
Semetic organization that committed genocide and murdered some
six million Jews as well as untold millions of homosexuals,
Poles, French, Dutch, East Europeans and Russians. He was a Nazi.
Not a Nazi of metaphor but a Nazi of the third Reich. Here is a
man who heads the richest most powerful ring of pedophiles in
the world. A man who wear huge rings of precious jewels and
lives in absolute luxury surrounded by treasures bought with
money scammed from his superstitious followers.
The odd ghoulish pathetic excuse for a human being actually has
the gall to pretend to speak with moral authority and condemn
people born LGBT/T who live their lives virtually identically to
most straights.}
------------------------------------------------------------------
AIDS Epidemic in San Francisco Among Men Who Report Sex with
San Francisco's gay male community has been hit harder by the
HIV/AIDS epidemic than ... Cohort data from the San Francisco
hepatitis B vaccine cohort
journals.lww.com - Home - 1997 - Volume 14 - Issue
------------------------------------------------------------------
Statistical Analysis Linking U.S. AIDS Outbreak to Hepatitis
hepatitis B vaccine report is required reading. Regards, ....
document, this group is known as the San Francisco Hepatitis B
Vaccine ...
Whalewww.whale.to/v/keske11.html
------------------------------------------------------------------
Who named San Francisco and why it is called San Francisco
Could you let me know what San Francisco is derived from- ....
There, a monk was born,of the San Francisco Order, that traveled
USA west ...
www.greenspun.com - LUSENET - San Francisco History
------------------------------------------------------------------
Order of Saint Benedict - Wikipedia, the free encyclopedia
For the black monk poltergeist haunting, see The Black Monk of
Pontefract. ... The Benedictine Confederation, which was
established in 1883 by Pope Leo XIII in
en.wikipedia.org/wiki/Order_of_Saint_Benedict
------------------------------------------------------------------
Beware monks pushing pope under bus - Catholic Light
Former Legionary priest Jack Keogh (aka Monk)'s response to Pope
Benedict's letter to the Irish, Is it time to convene the Third
Vatican ...
catholiclight.stblogs.org/archives/2010/03/the-kids-and-i.html
------------------------------------------------------------------
Mr. Monk in Outer Space - Google Books Result
"It is," Monk said. "But I don't know if it means anything."
"Have you found anything?" "A paper clip irregularity," Monk
said. "Is that serious?" He laid out the
books.google.com/books?isbn=1440633622
------------------------------------------------------------------
http://www.bibleprobe.com/last10popes.htm
Saint Malachy was a 12th century Irish monk, who, while on a
visit to Rome had a vision of all the popes who would ever reign.
Malachy "saw"-and committed to paper- a series of Latin phrases
describing the popes to come.
Amazingly, Pope John Paul II was the only pope who was both born
the day of an eclipse of the sun, and entombed the day the sun
was eclipsed.
John Paul II was the most traveled Pope in history. He has
circled the globe numerous times, preaching to huge audiences
everywhere he goes. Even though he was once shot, he has not
seemed to slow down. He has recently written a book which has
enjoyed a large circulation.
Like the sun which never ceases to labor and provides light
daily, this Pope has been incessant. John Paul compared abortion
to the Holocaust and denounced gay marriages as part of 'a new
ideology of evil'. He argued that same-sex marriages threaten
society by undermining the traditional family.
The Glory of the Olive. The Order of St. Benedict has said this
Pope will come from their order. It is interesting that Jesus
gave his apocalyptic prophecy about the end of time from the
Mount of Olives.
Also, St Benedict prophesized: before the end of the world his
Order, known also as the Olivetans, will triumphantly lead the
Catholic Church in its fight against evil. NOTHING was mentioned
as leading as a pope!
LOOK at the above again. The next pope will have something to do
with OLIVE --not necessarily or even probably a Benedictine.
------------------------------------------------------------------
Sandia Claus is Coming - alt.surrealism | Google Groups
Dec 23, 2012 <ptke...@comcast.net>.
... Syrian warplanes bomb olive oil factory; 20 killed
groups.google.com/group/alt.surrealism/.../5362357e58ca1ac1
------------------------------------------------------------------
Cancer-Causing Monkey Viruses Link to Oswald, JFK Murder
Jack Blood Interviews Edward Haslam ...
http://www.youtube.com/watch?v=zwzBys6EB-I
------------------------------------------------------------------
http://cerberuspetchow.blogspot.com/2007/10/yeats-perpetual-
reincarnation.html
Agu-Dabi and the Cerberus Pet Chow
"When the going gets weird, the weird turn pro" Raoul Duke
Yeats' perpetual reincarnation
~ Dismantling the propaganda matrix. ~
~ Empowering a community of social, economic and political justice. ~
------------------------------------------------------------------
Horton Hears a Hadoop - .alt.politics.org.nsa
Dec 17, 2011 - linguist, who called NSA a "haven for geeks and
nerds." "I saw a .... Kerberos ( Cerberus in Latin) was depicted
in Greek and Roman mythology ...
www.freag.net - alt - politics - org - nsa
------------------------------------------------------------------
http://www.tlaxcala.es/pp.asp?reference=7653&lg=en
From the CERBERUS scandal it became known that since 1972, the
German government, under the strictest secrecy, had financed the
development and construction of Israeli jamming transmitters for
Tornado aircraft. The total value of the plan was some 2.2
billion deutschmarks. The Israeli firm Elta was supposed to have
received about half of that. Some of the financial transactions
were conducted through the Mossad and BND secret services.
------------------------------------------------------------------
http://www.cerberussystems.com/INFOSEC/tutorial/winfosec.htm
Cerberus Systems, Inc. develops, manufactures and markets
software cryptosystems designed to level 1 of FIPS PUB 140-1
with DOD 5220.22-M disk data recovery countermeasures.
The NSA's National Cryptologic School defines information
security, or INFOSEC as a risk management program, of both
technical and operational measures, taken to counter threats to
sensitive information's confidentiality, integrity or
availability.
Access to DoD Classified information must be limited to
individuals who both possess the appropriate Personal Clearance
Level (PCL; i.e. Confidential, Secret or Top Secret/EBI/SBI),
and have been Indoctrinated for that program
------------------------------------------------------------------
URGENT -- 1000s UN Vehicles waiting for something in Florida
... neat little NSA/CIA operation titled the "Information
Sharing Council" or ISC. ... What would possess anybody to name
their corporation Cerberus? ... Microsoft named their network
authentication protocol Kerberos after him,
www.godlikeproductions.com/forum1/message1099425/
------------------------------------------------------------------
I Really Do Want Wayne LaPierre's Head on a Stick | Slog
That's the only responsible response to LaPierre's continued
ranting, ..... we over- reacted to the French Revolution by
passing laws such as the ...
slog.thestranger.com/.../i-really-do-want-wayne-lapierres-head-on-a-s...
------------------------------------------------------------------
http://www.amazon.com/Between-Love-and-Honor-ebook/dp/B006YYGWF8
It's probably better in its native French, but even of that I'm
not so sure.
But what really angered me about Lapierre's book was the fact
that, even 150 pages in (one-third of the book), we hadn't even
started on the main story. Supposedly the novel is about the
real-life story of Jamal Eddin, the son of Imam Shamil, who was
provided as a hostage to the Russian empire in order to seal a
truce of peace between the two warring nations. Jamal, a young
boy when he's "adopted" by Czar Nicholas I
Sounds fabulously dramatic and romantic, yet at 150 pages in, we'
ve only just gotten to the point where Jamal's father decides to
give in to Russia's demands and send Jamal to them as a hostage.
That's one-third of the book gone and we haven't even gotten to
Russia yet? As Charlie Brown would say, Good grief!
------------------------------------------------------------------
http://www.erudit.org/revue/ron/1997/v/n8/005773ar.html
Camille Paglia goes so far as to contend: "Protestant
rationalism is defeated by Gothic's return to the ritualism and
mysticism of medieval Catholicism, with its residual paganism."
Gothicism contains buried within it a pro Catholic nostalgia
counter to its anti-Catholic surface. This tension became
turbulent and urgent, since the French Revolution awakened
Catholic/Protestant debate.
------------------------------------------------------------------
Monk (comics) - Wikipedia, the free encyclopedia
The Monk is a vampire who wears a red, monk-like outfit, with a
hood that bears a skull and crossbones. The Monk hypnotises
Bruce Wayne's fiancee, Julie ...
en.wikipedia.org/wiki/Monk_(comics)
The Monk first appeared in Detective Comics #31 in 1939. He is
one of the earliest significant villains of the series, his
battle with Batman being one of the Dark Knight's first multi-
part adventures. The Monk is a vampire who wears a red, monk-
like outfit, with a hood that bears a skull and crossbones. The
Monk hypnotises Bruce Wayne's fiancee, Julie Madison, into
trying to kill a man.
Batman stops her and next day as Bruce Wayne takes her to a
Doctor, who has also been hypnotised and tells them to go on a
cruise. Batman uses the Batgyro to get to the ship Julie is on
and meets the Monk who is after Julie. The Monk tries to use his
hypnotic powers on Batman
Although later events have called this story into question, the
Monk's continued existence in the post-Crisis version of the DC
Universe was confirmed by the presence of a familiar red hood
displayed as a trophy in the Batcave.
DC began publishing a six-issue miniseries by writer/artist Matt
Wagner called Batman and the Mad Monk.
------------------------------------------------------------------
http://slayageonline.com/essays/slayage7/Introvigne.htm
Brainwashing the Working Class: Vampire Comics
and Criticism from Dr. Occult to Buffy
In the 1959 novel The Manchurian Candidate by Richard Thomas
Condon (1915-1996), the sinister Dr. Yen Lo subjects an American
patrol captured during the Korean War to brainwashing, and
explains how it all works to an audience of Chinese and Soviet
generals. Brainwashing is not so uncommon, Dr. Yen Lo explains:
as a certain Dr. Wertham recently proved, even Americans
routinely brainwash their working class children through horror
comics featuring vampires and other monsters
According to Wertham, most comic books induce a sort of negative
conditioning in America's youth leading to juvenile delinquency,
totalitarian politics, and sexual problems (including
homosexuality). Wertham's book and his testimony before Congress
led to the signing in 1954 of the Comics Code that included a
ban on representing horror themes and characters in American
comic books. Similar or more draconian results were achieved in
the U.K. through the passage of the Children and Young persons [
Harmful Publications] Act and in France by the strict
enforcement of the law of July 16, 1949 (which had introduced a
censorship on all juvenile publications)[18], whilst in Italy an
earlier anti-comic offensive led by Catholic politicians
generated a draft law which was defeated in Parliament after
some prominent Catholic intellectuals, including conservative
novelist Giovanni Guareschi [1908-1968, who happened to be a
comic fan himself], came out in favor of comics
Three years later, Batman himself in its fifth Detective Comics
story (issues 31, Oct. 1939, and 32, Nov. 1939) had to deal with
a vampire, The Monk, and his female assistant Darla in order to
save his girlfriend Julie Madison. Batman did indeed have a
girlfriend at that time, and as late as May 1997, in no. 94 of
Batman: Legends of the Dark Knight
------------------------------------------------------------------
http://www.necn.com/02/02/13/Vandalism-at-3-Mass-churches/
landing.html?blockID=828777&feedID=11106
(NECN: Julie Loncich, Wilmington, Mass.) - The words and images
are disturbing. Written in red, the words "brain washing"
stenciled on three churches in Wilmington, Mass. were discovered
early Saturday morning
------------------------------------------------------------------
The Madness of Pope Benedict | Rule Hibernia
The Pope wants people to leave the Irish Catholic church. No you
say? Well it's the most logical explanation I can come up with
after ...
rulehibernia.com/2010/08/the-madness-of-pope-benedict/
------------------------------------------------------------------
The Mad Monk
... with the Empress is thus the crucial issue to be faced by
anyone seeking to understand the history of the Russian
Revolution.
www.nytimes.com/books/97/11/30/reviews/971130.30massiet.html
------------------------------------------------------------------
Morbid Monday: Mad Monks & Bullet-Proof Corsets | Atlas Obscura
Only in the forest did I finally discover the reason why it had
been so hard to kill the daughters and Alexandra Feodrovna....
the ... Grigori Rasputin, the Mad Monk of Russia (source) ...
Revolutions had been tearing at Russia for a decade
www.atlasobscura.com/.../morbid-monday-mad-monks-bullet-proof-...
------------------------------------------------------------------
But as hypothetical Jim Warren falls, I rise up, the Dulles
Stigmata gnawing at my soul, as the ring poison has on his.
I am the cold, dark one.
I am the Last Witness. I wash clean the blood.
------------------------------------------------------------------
|
|